PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 494aa    MW: 52225.6 Da    PI: 8.1374
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019275genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC772e-24168212145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Lus10019275 168 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 212
                  79****************************************985 PP

2QLQ52.91.1e-1896132137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+ +L++Q+l+yKy+ an+ vP++Ll +++k
  Lus10019275  96 GPFTPSQWIELEHQALIYKYITANVAVPSNLLNPLKK 132
                  59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-996132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.46897132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.3E-1397130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287168212IPR014977WRC domain
PfamPF088796.0E-21169211IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MDFGVLGSQQ SPYLLHPPDS NQNTISTLGS DAACCKPSKI PRTSSMPHAS GLLRSNSTSN  60
MLSFSNSAPY HHYPPTPGSL SATMHGAAAA FTGFRGPFTP SQWIELEHQA LIYKYITANV  120
AVPSNLLNPL KKSLYPFALS SSSSAASFIP GSLGWGAFHL GYPGSTNDPE PGRCRRTDGK  180
KWRCSRDAVA DQKYCERHIN RGRHRSRKPV EGQSGHGVSG TKVVQQVATS TSAITNNSAA  240
AAAASCIGIA SQQQQLKNLQ LQHQHANASR FAVSKVNASS LMSVPKQNVQ IEESHCHSEF  300
GLVSYDSLLN PSQQGSTTSC YNTSFLSFSD QDTQDQHSLH QFMDNDWQHK DGQSTRNVIS  360
WPEELKSDWT QLSMSIPMAP SDFSSSSSSP AHEKLALSPW GGGGGGASMG GGPLGEVLTT  420
SASANAGCWD GSSPPQPGFS PTGVLQKATF ASQSNSSTGS SPRGGDHSKR NSLCDDVLGS  480
NIMSSSTTAV PSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8861694e-71HQ886169.1 Linum usitatissimum clone Contig2117 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890408.11e-134PREDICTED: growth-regulating factor 1 isoform X1
RefseqXP_015890409.11e-134PREDICTED: growth-regulating factor 1 isoform X2
TrEMBLA0A067GGN01e-132A0A067GGN0_CITSI; Uncharacterized protein
STRINGPOPTR_0014s00780.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-81growth-regulating factor 1